PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10027162m
Common NameEUTSA_v10027162mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family M-type_MADS
Protein Properties Length: 79aa    MW: 9100.72 Da    PI: 10.4603
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10027162mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.51e-29959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krien + rqvtfskRrng+lKKA+ELSvLCdaeva+ii+s++ k+ye+ss
  Thhalv10027162m  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIILSPRSKIYEFSS 59
                     79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.1E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.74161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.62E-29364IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-30323IPR002100Transcription factor, MADS-box
CDDcd002653.19E-35360No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003199.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-303859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 79 aa     Download sequence    Send to blast
MVRGKTEMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIILSP RSKIYEFSSS  60
RYISFFHPSP FVFLFYLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A2e-16360259Myocyte-specific enhancer factor 2A
3mu6_B2e-16360259Myocyte-specific enhancer factor 2A
3mu6_C2e-16360259Myocyte-specific enhancer factor 2A
3mu6_D2e-16360259Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0310185e-63AL031018.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F7H19 (ESSA project).
GenBankAL1615585e-63AL161558.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 58.
GenBankCP0026875e-63CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006413596.14e-51hypothetical protein EUTSA_v10027162mg
SwissprotO827434e-35AGL19_ARATH; Agamous-like MADS-box protein AGL19
TrEMBLV4MF185e-51V4MF18_EUTSA; Uncharacterized protein
STRINGPOPTR_0001s08510.17e-35(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.12e-36AGAMOUS-like 19